PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00036.1.g00820.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 568aa    MW: 61593.6 Da    PI: 7.2282
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00036.1.g00820.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS395.45.9e-1211034231374
                          GRAS  31 aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeer 111
                                   a ++++ + R+a +ft AL++rl+   +      p+s+ +    ++++  ++ f+e++P+lkf+h+taNqaIleav+g  +
  Zjn_sc00036.1.g00820.1.am.mk  10 AVSAASGIGRVAVHFTAALSRRLFP--P------PTSPPPAPPAADHALLYHHFYEACPYLKFAHFTANQAILEAVQGRAE 82 
                                   556678999***************9..3......33333333379999********************************* PP

                          GRAS 112 vHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                                   vH+iDf+++qGlQWpaL+qaLa Rp+gpp lRiTg+g+p++  ++ l+ +g rLa++A++++vpf f+ ++a+rl++++++
  Zjn_sc00036.1.g00820.1.am.mk  83 VHVIDFSLMQGLQWPALIQALALRPGGPPFLRITGIGPPSPPGRDDLRDVGLRLADLARSVRVPFAFRGVAANRLDEVRPW 163
                                   ********************************************************************************* PP

                          GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                                   +L+v+pgEa+aVn+vlqlhrll ++ + + ++d+vL++v s++Pkv++vveqeadhn++ Fl+rf+eal yysa+fdsl+a
  Zjn_sc00036.1.g00820.1.am.mk 164 MLQVSPGEAVAVNSVLQLHRLLGDPSADRAPIDAVLDCVSSVRPKVFTVVEQEADHNKPGFLDRFTEALFYYSAVFDSLDA 244
                                   *******************************************************************************99 PP

                          GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                                          +  +v +++l+rei+++v++ega r+erhe l++Wrerl++aG+ +vpl+ +a  qa++l+  ++++g+ vee 
  Zjn_sc00036.1.g00820.1.am.mk 245 A---SGGAGDTVAEAYLEREICDIVCAEGAVRKERHEPLQRWRERLGRAGLAAVPLGANALRQARMLVGLFSGEGHCVEEA 322
                                   9...358888999999***************************************************************** PP

                          GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                                   +g+l+lgW++rpL+s+SaWr
  Zjn_sc00036.1.g00820.1.am.mk 323 EGCLTLGWHGRPLFSASAWR 342
                                   *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.8061322IPR005202Transcription factor GRAS
PfamPF035142.0E-11810342IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
LADAHATLAA VSAASGIGRV AVHFTAALSR RLFPPPTSPP PAPPAADHAL LYHHFYEACP  60
YLKFAHFTAN QAILEAVQGR AEVHVIDFSL MQGLQWPALI QALALRPGGP PFLRITGIGP  120
PSPPGRDDLR DVGLRLADLA RSVRVPFAFR GVAANRLDEV RPWMLQVSPG EAVAVNSVLQ  180
LHRLLGDPSA DRAPIDAVLD CVSSVRPKVF TVVEQEADHN KPGFLDRFTE ALFYYSAVFD  240
SLDAASGGAG DTVAEAYLER EICDIVCAEG AVRKERHEPL QRWRERLGRA GLAAVPLGAN  300
ALRQARMLVG LFSGEGHCVE EAEGCLTLGW HGRPLFSASA WRAEENNPSD SNVDGSNGSE  360
ESNISCSLRC AAVAWFRGKS SRMHASAYSS GFGRRAGTVM RAAARRVSSK PKGCEGTLLG  420
TLQQRKAGYV SETQVRAPRS HLRSPRACER QRGEEERFGH RSTMQLIEEE KQLDSSAVFP  480
MEGKEMVGFA SKLAAETATL REVYVLGDVE GVRRRAEQPP LREPNGVEPV PPFPAVREGS  540
SGHAFSREDV ASVLQSRKTE RPVSDDDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-55434222375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969307.10.0PREDICTED: DELLA protein DWARF8-like
SwissprotQ9LQT81e-128GAI_ARATH; DELLA protein GAI
TrEMBLK3XHC20.0K3XHC2_SETIT; Uncharacterized protein
STRINGSi001293m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-125GRAS family protein